The Telo_bind domain within your query sequence starts at position 11 and ends at position 141, and its E-value is 3.6e-53.

YTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQTNVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWAS
Telo_bind

Telo_bind

Telomeric single stranded DNA binding POT1/CDC13
SMART ACC:SM000976
Description:The telomere-binding protein forms a heterodimer in ciliates consisting of an alpha and a beta subunit. This complex may function as a protective cap for the single-stranded telomeric overhang. Alpha subunit consists of 3 structural domains, all with the same beta-barrel OB fold.
InterPro ACC:IPR011564
InterPro abstract:

This domain binds single stranded telomeric DNA and adopts an OB fold [ PUBMED:11935027 ]. It includes the proteins POT1 and Cdc13 which have been shown to regulate telomere length, replication and capping [ PUBMED:11230149 expand

GO process:telomere maintenance (GO:0000723)
GO component:chromosome, telomeric region (GO:0000781)
GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 021 Telo_bind domains in 1 020 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Telo_bind domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Telo_bind domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the Telo_bind domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Telo_bind domain which could be assigned to a KEGG orthologous group, and not all proteins containing Telo_bind domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTelo_bind
InterProIPR011564