The PD domain within your query sequence starts at position 297 and ends at position 350, and its E-value is 1.4e-14.

YTVEWDDSIRDEEKIDCYPDQHGASETSCTARGCVWEESNSDVVPFCYFVNELY
PD

PD

P or trefoil or TFF domain
SMART ACC:SM000018
Description:Proposed role in renewal and pathology of mucous epithelia.
InterPro ACC:IPR000519
InterPro abstract:

A cysteine-rich domain of approximately forty five amino-acid residues has been found in some extracellular eukaryotic proteins [ PUBMED:7820556 PUBMED:9187350 PUBMED:8518738 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 239 PD domains in 2 058 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PD domain which could be assigned to a KEGG orthologous group, and not all proteins containing PD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEP_DOMAIN
InterProIPR000519
Pfamtrefoil