The Alpha_adaptinC2 domain within your query sequence starts at position 707 and ends at position 817, and its E-value is 2.94e-18.

YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFS
Alpha_adaptinC2

Alpha_adaptinC2

Adaptin C-terminal domain
SMART ACC:SM000809
Description:Adaptins are components of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. Gamma-adaptin is a subunit of the golgi adaptor. Alpha adaptin is a heterotetramer that regulates clathrin-bud formation. The carboxyl-terminal appendage of the alpha subunit regulates translocation of endocytic accessory proteins to the bud site. This Ig-fold domain is found in alpha, beta and gamma adaptins and consists of a beta-sandwich containing 7 strands in 2 beta-sheets in a greek-key topology (PUBMED:10430869), (PUBMED:12176391). The adaptor appendage contains an additional N-terminal strand.
InterPro ACC:IPR008152
InterPro abstract:

This entry represents a β-sandwich structural motif found in the appendage (ear) domain of alpha-, beta-and gamma-adaptin from AP clathrin adaptor complexes, and the GAE (gamma-adaptin ear) domain of GGA adaptor proteins. These domains have an immunoglobulin-like β-sandwich fold containing 7 or 8 strands in 2 β-sheets in a Greek key topology [ PUBMED:12042876 expand

GO process:vesicle-mediated transport (GO:0016192), intracellular protein transport (GO:0006886)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 124 Alpha_adaptinC2 domains in 7 120 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Alpha_adaptinC2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Alpha_adaptinC2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the Alpha_adaptinC2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Alpha_adaptinC2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Alpha_adaptinC2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAlpha_adaptinC2
InterProIPR008152