The LRRNT domain within your query sequence starts at position 31 and ends at position 65, and its E-value is 1.74e-4.

ACPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDP
LRRNT

LRRNT

Leucine rich repeat N-terminal domain
SMART ACC:SM000013
Description: -
InterPro ACC:IPR000372
InterPro abstract:

Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [ PUBMED:14747988 ]. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 42 000 LRRNT domains in 37 397 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LRRNT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LRRNT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LRRNT domain.

ProteinDescriptionDisease / phenotype
GPIX_HUMANOMIM:173515 : Bernard-Soulier syndrome, type C

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LRRNT domain which could be assigned to a KEGG orthologous group, and not all proteins containing LRRNT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000372