The PSN domain within your query sequence starts at position 218 and ends at position 486, and its E-value is 3.65e-102.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 22072745 ) for details.

DYLTFSPLTVVVFVVICCIMIVLLYFFYRWLVYVMIAIFCIASSMSLYNCLSALIHRMPCGQCTILCCGKNIKVSLIFLSGLCISVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTMKLPNFMSCVILLGLLLIYDVFFVFITPFITKNGESIMVELAAGPFENAEKLPVVIRVPKLMGYSVMSVCSVPVSVLGFGDIIVPGLLIAYCRRFDVQTGSSIYYISSTIAYAVGMIITFVVLMVMKTGQPALLYLVPCTLITVSVVAWSR
PSN

PSN

Presenilin, signal peptide peptidase, family
SMART ACC:SM000730
Description:Presenilin 1 and presenilin 2 are polytopic membrane proteins, whose genes are mutated in some individuals with Alzheimer's disease. Distant homologues, present in eukaryotes and archaea, also contain conserved aspartic acid residues which are predicted to contribute to catalysis. At least one member of this family has been shown to possess signal peptide peptidase activity.
InterPro ACC:IPR006639
InterPro abstract:

Presenilin 1 (PSN1) and presenilin 2 (PSN2) are membrane proteins, whose genes are mutated in some individuals with Alzheimer's disease. They undergo tightly regulated endolytic processing to generate stable PSN C-terminal and N-terminal fragments that form the catalytic core of the gamma-secretase complex, an endoprotease complex that catalyses the intramembrane cleavage of integral membrane … expand

GO component:membrane (GO:0016020)
GO function:aspartic endopeptidase activity, intramembrane cleaving (GO:0042500)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 435 PSN domains in 6 426 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PSN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PSN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Likely aspartyl protease

Relevant references for this domain

Primary literature for the PSN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PSN domain which could be assigned to a KEGG orthologous group, and not all proteins containing PSN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006639