The NUC domain within your query sequence starts at position 662 and ends at position 892, and its E-value is 1.32e-109.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 9257723 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
63724DNo
66727HNo
103764ENo
HTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERNGVNVISGPIFDYNYNGLRDIEDEIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGLDFYRKTSRS
NUC

NUC

DNA/RNA non-specific endonuclease
SMART ACC:SM000477
Description:prokaryotic and eukaryotic double- and single-stranded DNA and RNA endonucleases also present in phosphodiesterases
InterPro ACC:IPR020821
InterPro abstract:

A family of bacterial and eukaryotic endonucleases EC:3.1.30 share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. A histidine has been shown [ PUBMED:8078761 expand

GO function:metal ion binding (GO:0046872), nucleic acid binding (GO:0003676), hydrolase activity (GO:0016787)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 868 NUC domains in 11 849 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NUC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NUC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NUC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NUC domain which could be assigned to a KEGG orthologous group, and not all proteins containing NUC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR020821
PfamEndonuclease