The MAGUK_N_PEST domain within your query sequence starts at position 10 and ends at position 97, and its E-value is 3.39e-37.

KKYRYQDEDTPPLEHSPAHLPNQVNAPELVHVAERNLSHLEAVHGVVGHAHLSSLKANSPPVIVNTDTLEAPGYVNGTEGEMEYEEIT
MAGUK_N_PEST

MAGUK_N_PEST

Polyubiquitination (PEST) N-terminal domain of MAGUK
SMART ACC:SM001277
Description:The residues upstream of this domain are the probable palmitoylation sites, particularly two cysteines. The domain has a putative PEST site at the very start that seems to be responsible for poly-ubiquitination PMID:8755249. PEST domains are polypeptide sequences enriched in proline (P), glutamic acid (E), serine (S) and threonine (T) that target proteins for rapid destruction. The whole domain, in conjunction with a C-terminal domain of the longer protein, is necessary for dimerisation of the whole protein PMID:18215622.
InterPro ACC:IPR019590
InterPro abstract:

This domain can be found in Disks large homologue 1 (DLG1 or SAP97), a membrane-associated guanylate kinase protein (MAGUK) that serves as an important determinant of localization and organisation of ion channels into specific plasma membrane domains [ PUBMED:18245566 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 836 MAGUK_N_PEST domains in 2 831 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MAGUK_N_PEST domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MAGUK_N_PEST domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MAGUK_N_PEST domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MAGUK_N_PEST domain which could be assigned to a KEGG orthologous group, and not all proteins containing MAGUK_N_PEST domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019590
PfamMAGUK_N_PEST