The HOX domain within your query sequence starts at position 626 and ends at position 700, and its E-value is 2.1e-6.

KRKGRQSNWNPQHLLILQAQFASSLRETAEGKYIMSDLGPQERVHISKFTGLSMTTISHWLANVKYQLRRTGGTK
HOX

HOX

Homeodomain
SMART ACC:SM000389
Description:DNA-binding factors that are involved in the transcriptional regulation of key developmental processes
InterPro ACC:IPR001356
InterPro abstract:

This entry represents the homeodomain (HD), a protein domain of approximately 60 residues that usually binds DNA. It is encoded by the homeobox sequence [ PUBMED:26464018 PUBMED:19734295 PUBMED:17963489 expand

GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 130 113 HOX domains in 120 724 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HOX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HOX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription
Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the HOX domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the HOX domain.

ProteinDescriptionDisease / phenotype
PITX2_HUMANOMIM:137600 : Iridogoniodysgenesis syndrome
OMIM:601542 : Rieger syndrome
OMIM:180500 : Iridogoniodysgenesis syndrome-2
OMIM:137600 : no description
MSX2_HUMANOMIM:123101 : Craniosynostosis, type 2
OMIM:604757 : Parietal foramina 1
OMIM:168500 : no description
OMIM:168500 : Parietal foramina
PDX1_HUMANOMIM:600733 : Pancreatic agenesis
OMIM:260370 : MODY, type IV
MSX1_HUMANOMIM:142983 : Hypodontia, autosomal dominant
OMIM:106600 : Hypodontia with orofacial cleft
OMIM:106600 : no description
NKX25_HUMANOMIM:600584 : Atrial septal defect with atrioventricular conduction defects
OMIM:108900 : no description
PIT1_HUMANOMIM:173110 : Pituitary hormone deficiency, combined
PAX3_HUMANOMIM:193500 : Waardenburg syndrome, type I ; Waardenburg syndrome, type III
OMIM:148820 : Rhabdomyosarcoma, alveolar
OMIM:268220 : Craniofacial-deafness-hand syndrome
OMIM:122880 : no description
SIX3_HUMANOMIM:157170 : Holoprosencephaly-2
OMIM:603714 : Holoprosencephaly-2
OMIM:157170 : no description
PROP1_HUMANOMIM:601538 : Pituitary hormone deficiency, combined
ALX4_HUMANOMIM:168500 : Parietal foramina
OMIM:605420 : Parietal foramina 2
OMIM:168500 : no description
PO3F4_HUMANOMIM:300039 : Deafness, X-linked 3, conductive, with stapes fixation
OMIM:304400 : no description
TGIF1_HUMANOMIM:142946 : Holoprosencephaly-4
OMIM:602630 : Holoprosencephaly-4
OMIM:142946 : no description
CRX_HUMANOMIM:602225 : Cone-rod retinal dystrophy-2
OMIM:120970 : Leber congenital amaurosis due to defect in CRX
OMIM:204000 : Retinitis pigmentosa, late-onset dominant
HESX1_HUMANOMIM:601802 : Septooptic dysplasia
OMIM:182230 : no description
LMX1B_HUMANOMIM:602575 : Nail-patella syndrome
OMIM:161200 : Nail-patella syndrome with open-angle glaucoma
OMIM:137750 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HOX domain which could be assigned to a KEGG orthologous group, and not all proteins containing HOX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEHOMEOBOX_2
InterProIPR001356
Pfamhomeobox