The VPS9 domain within your query sequence starts at position 612 and ends at position 730, and its E-value is 1.72e-68.

LMELEKIKLKFMTMQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSEARD
VPS9

VPS9

Domain present in VPS9
SMART ACC:SM000167
Description:Domain present in yeast vacuolar sorting protein 9 and other proteins.
InterPro ACC:IPR003123
InterPro abstract:

Rab proteins form a family of signal-transducing GTPases that cycle betweenactive GTP-bound and inactive GDP-bound forms. The Rab5 GTPase is an essentialregulator of endocytosis and endosome biogenesis. Rab5 is activated by GDP-GTPexchange factors (GEFs) that contain a VPS9 domain and generate the Rab5-GTPcomplex [ PUBMED:16330212 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 182 VPS9 domains in 5 180 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VPS9 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VPS9 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the VPS9 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VPS9 domain which could be assigned to a KEGG orthologous group, and not all proteins containing VPS9 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003123