The S_TKc domain within your query sequence starts at position 24 and ends at position 308, and its E-value is 1.67e-84.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 7768349 ) for details.

LQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYF
S_TKc

S_TKc

Serine/Threonine protein kinases, catalytic domain
SMART ACC:SM000220
Description:Phosphotransferases. Serine or threonine-specific kinase subfamily.
InterPro ACC:IPR000719
InterPro abstract:

This entry represents the protein kinase domain containing the catalytic function of protein kinases [ PUBMED:1956325 ]. This domain is found in serine/threonine-protein kinases, tyrosine-protein kinases and dual specificity protein kinases.

Eukaryotic protein kinases [ PUBMED:1956325 expand

GO process:protein phosphorylation (GO:0006468)
GO function:ATP binding (GO:0005524), protein kinase activity (GO:0004672)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 221 171 S_TKc domains in 218 906 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing S_TKc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing S_TKc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Serine-specific phosphotransferase, threonine-specific phosphotransferase

Relevant references for this domain

Primary literature for the S_TKc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the S_TKc domain.

ProteinDescriptionDisease / phenotype
KS6A3_HUMANOMIM:300075 : Coffin-Lowry syndrome
OMIM:303600 : Mental retardation, X-linked nonspecific, type 19
TIE2_HUMANOMIM:600221 : Venous malformations, multiple cutaneous and mucosal
OMIM:600195 : no description
CDK4_HUMANOMIM:123829 : Melanoma
MET_HUMANOMIM:164860 : Renal cell carcinoma, papillary, familial and sporadic
OMIM:605074 : Hepatocellular carcinoma, childhood type
OMIM:114550 : no description
BTK_HUMANOMIM:300300 : Agammaglobulinemia, type 1, X-linked ; ?XLA and isolated growth hormone deficiency
OMIM:307200 : no description
PHKG2_HUMANOMIM:172471 : Glycogenosis, hepatic, autosomal
RET_HUMANOMIM:164761 : Multiple endocrine neoplasia IIA
OMIM:171400 : Medullary thyroid carcinoma
OMIM:155240 : Multiple endocrine neoplasia IIB
OMIM:162300 : Hirschsprung disease
OMIM:142623 : no description
OMIM:188550 : Thyroid papillary carcinoma
ZAP70_HUMANOMIM:176947 : Selective T-cell defect
KPCG_HUMANOMIM:176980 : PROTEIN KINASE C, GAMMA; PRKCG
ACVL1_HUMANOMIM:601284 : Hereditary hemorrhagic telangiectasia-2
OMIM:600376 : no description
INSR_HUMANOMIM:147670 : Leprechaunism
OMIM:246200 : Rabson-Mendenhall syndrome
OMIM:262190 : Diabetes mellitus, insulin-resistant, with acanthosis nigricans
KIT_HUMANOMIM:164920 : Piebaldism ; Mast cell leukemia ; Mastocytosis with associated hematologic disorder ; Germ cell tumors
OMIM:273300 : no description
TGFR2_HUMANOMIM:190182 : Colon cancer ; Colorectal cancer, hereditary nonpolyposis, type 6
OMIM:114500 : Esophageal cancer
OMIM:133239 : no description
RK_HUMANOMIM:180381 : Oguchi disease-2
OMIM:258100 : no description
GUC2D_HUMANOMIM:601777 : Cone dystrophy, progressive
OMIM:600179 : Leber congenital amaurosis, type I
OMIM:204000 : Cone-rod dystrophy 6
OMIM:601777 : no description
NTRK1_HUMANOMIM:191315 : Insensitivity to pain, congenital, with anhidrosis
OMIM:256800 : Medullary thyroid carcinoma, familial
OMIM:155240 : no description
FGFR3_HUMANOMIM:134934 : Achondroplasia
OMIM:100800 : Hypochondroplasia
OMIM:146000 : Thanatophoric dysplasia, types I and II
OMIM:187600 : Crouzon syndrome with acanthosis nigricans ; Muencke syndrome
OMIM:602849 : no description
OMIM:600593 : Craniosynostosis, Adelaide type
STK11_HUMANOMIM:602216 : Peutz-Jeghers syndrome
OMIM:175200 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a S_TKc domain which could be assigned to a KEGG orthologous group, and not all proteins containing S_TKc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000719
Pfampkinase