The GAF domain within your query sequence starts at position 877 and ends at position 1066, and its E-value is 1.78e-2.

LRNCARRKWLHQIQYAAETSGVSLEPVYTETFRVLTQDAEAHGNKKISAHISLLEENVFLPERGHVLLRNVACTLDDAPFVLNKVLYRDMKGISFTVVDEGKPIHVPQVQHHGNIFFWNSFRSKNEYNGSFLALPLQDAYMRIFGVLAVDTLRDPHEINIFLPHEIKFYQGVANAFSTAYHHVHSREHVL
GAF

GAF

Domain present in phytochromes and cGMP-specific phosphodiesterases.
SMART ACC:SM000065
Description:Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.
InterPro ACC:IPR003018
InterPro abstract:

The GAF domain is named after some of the proteins it is found in, including cGMP-specific phosphodiesterases, adenylyl cyclases and FhlA. It is also found in guanylyl cyclases and phytochromes [ PUBMED:9433123 PUBMED:20004158 ]. The structure … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 232 204 GAF domains in 203 968 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GAF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GAF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Chromophore-binding

Relevant references for this domain

Primary literature for the GAF domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the GAF domain.

ProteinDescriptionDisease / phenotype
PDE6A_HUMANOMIM:180071 : Retinitis pigmentosa, autosomal recessive
PDE6B_HUMANOMIM:180072 : Night blindness, congenital stationary, type 3
OMIM:163500 : Retinitis pigmentosa, autosomal recessive

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GAF domain which could be assigned to a KEGG orthologous group, and not all proteins containing GAF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003018