The Mre11_DNA_bind domain within your query sequence starts at position 62 and ends at position 170, and its E-value is 1.81e-32.

MNMQKLPLRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLGNPQQPGKPLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHR
Mre11_DNA_bind

Mre11_DNA_bind

Mre11 DNA-binding presumed domain
SMART ACC:SM001347
Description:The Mre11 complex is a multi-subunit nuclease that is composed of Mre11, Rad50 and Nbs1/Xrs2, and is involved in checkpoint signalling and DNA replication (PMID:11988766). Mre11 has an intrinsic DNA-binding activity that is stimulated by Rad50 on its own or in combination with Nbs1 (PMID:10823903).
InterPro ACC:IPR007281
InterPro abstract:

This entry represents the DNA binding domain of Double-strand break repair protein Mre11 and similar eukaryotic sequences.

The MRN complex is a multi-subunit nuclease that is composed of Mre11, Rad50 and Nbs1/Xrs2, and is involved in checkpoint signalling, double-strand break (DSB) repair, DNA replication, maintenance of telomere integrity and meiosis, promoting genomic stability [ expand

GO process:double-strand break repair (GO:0006302)
GO component:nucleus (GO:0005634)
GO function:manganese ion binding (GO:0030145), endonuclease activity (GO:0004519)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 809 Mre11_DNA_bind domains in 1 809 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Mre11_DNA_bind domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Mre11_DNA_bind domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Replication

Relevant references for this domain

Primary literature for the Mre11_DNA_bind domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Mre11_DNA_bind domain which could be assigned to a KEGG orthologous group, and not all proteins containing Mre11_DNA_bind domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMre11_DNA_bind
InterProIPR007281