The Frizzled domain within your query sequence starts at position 192 and ends at position 517, and its E-value is 5.6e-184.

MYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKK
Frizzled

Frizzled

Frizzled/Smoothened family membrane region
SMART ACC:SM001330
Description:Frizzled is a family of G protein-coupled receptor proteins (PMID: 14977528) that serves as receptors in the Wnt signaling pathway and other signaling pathways. When activated, Frizzled leads to activation of Dishevelled in the cytosol.
InterPro ACC:IPR000539
InterPro abstract:

This domain is the membrane spanning region of frizzled and smoothened receptors. This membrane region is predicted to contain seven transmembrane α-helices. Proteins related to Drosophila frizzled ( P18537 ) are receptors for Wnt (mediating the beta-catenin signalling pathway) [ PUBMED:8717036 expand

GO process:cell surface receptor signaling pathway (GO:0007166)
GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 099 Frizzled domains in 5 097 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Frizzled domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Frizzled domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the Frizzled domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Frizzled domain which could be assigned to a KEGG orthologous group, and not all proteins containing Frizzled domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFrizzled
InterProIPR000539