The PP2Ac domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 7500362 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
N/AN/ADNo
N/AN/AHNo
NSMNDNALEDSISNPVANRKLIADYFEDDSASADGSTDPEMYIFSDVYQARSAS
PP2Ac

PP2Ac

Protein phosphatase 2A homologues, catalytic domain.
SMART ACC:SM000156
Description:Large family of serine/threonine phosphatases, that includes PP1, PP2A and PP2B (calcineurin) family members.
InterPro ACC:IPR006186
InterPro abstract:

Protein phosphorylation plays a central role in the regulation of cell functions [ PUBMED:2827745 ], causing the activation or inhibition of many enzymes involved in various biochemical pathways [ PUBMED:2176161 ]. Kinases and phosphatases are … expand

GO function:hydrolase activity (GO:0016787)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 25 154 PP2Ac domains in 25 130 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PP2Ac domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PP2Ac domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PP2Ac domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PP2Ac domain which could be assigned to a KEGG orthologous group, and not all proteins containing PP2Ac domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006186
PfamSTphosphatase