The SCAN domain within your query sequence starts at position 37 and ends at position 149, and its E-value is 2.75e-57.

PETARQLFRQFRYQVLSGPQETLRQLRKLCFQWLRPEVHTKEQILELLMLEQFLTILPGEIQMWVRKQCPGSGQEAVTLVESLKGEPQKLWHWISTQVLGQEIPFEKENLTHC
SCAN

SCAN

leucine rich region
SMART ACC:SM000431
Description: -
InterPro ACC:IPR003309
InterPro abstract:

A number of C2H2-zinc finger proteins contain a highly conserved N-terminal motif termed the SCAN (named after SRE-ZBP, CTfin51, AW-1 and Number 18 cDNA) domain. The SCAN domain has been shown to be able to mediate homo- and hetero-oligomerisation [ PUBMED:10567577 ]. These proteins can either activate or repress transcription … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 360 SCAN domains in 9 259 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SCAN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SCAN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SCAN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SCAN domain which could be assigned to a KEGG orthologous group, and not all proteins containing SCAN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003309