The BPI1 domain within your query sequence starts at position 25 and ends at position 191, and its E-value is 1.77e-40.

RVTSAALDLVKQEGLRFLEQELETITIPDVYGAKGHFYYNISDVRVTQLHLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFLRMYNFFSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDDLVGIDYSLLKDPVVSNGNLDMEFRGAFFPLKE
BPI1

BPI1

BPI/LBP/CETP N-terminal domain
SMART ACC:SM000328
Description:Bactericidal permeability-increasing protein (BPI) / Lipopolysaccharide-binding protein (LBP) / Cholesteryl ester transfer protein (CETP) N-terminal domain
InterPro ACC:IPR017942
InterPro abstract:

This entry represents the N-terminal domain found in several lipid-binding serum glycoproteins. The N- and C-terminal domains share a similar two-layer α/β structure, but they show little sequence identity. Proteins containing this N-terminal domain include:

  • Bactericidal permeability-increasing protein (BPI)
  • Lipopolysaccharide-binding protein (LBP)
  • Cholesteryl … expand
GO function:lipid binding (GO:0008289)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 980 BPI1 domains in 2 959 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BPI1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BPI1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BPI1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BPI1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing BPI1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamLBP_BPI_CETP
PROSITELBP_BPI_CETP
InterProIPR017942