The S_TK_X domain within your query sequence starts at position 212 and ends at position 273, and its E-value is 7.03e-23.

STIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTPRDSPGIPPSAGAHQLFRGFSFVA
S_TK_X

S_TK_X

Extension to Ser/Thr-type protein kinases
SMART ACC:SM000133
Description: -
InterPro ACC:IPR000961
InterPro abstract:

The AGC (cAMP-dependent, cGMP-dependent and protein kinase C) protein kinase family embraces a collection of protein kinases that display a high degree of sequence similarity within their respective kinase domains. AGC kinase proteins are characterised by three conserved phosphorylation sites that critically regulate their function. The first one is located in an activation loop in the centre … expand

GO process:protein phosphorylation (GO:0006468)
GO function:ATP binding (GO:0005524), protein serine/threonine kinase activity (GO:0004674)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 38 412 S_TK_X domains in 38 361 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing S_TK_X domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing S_TK_X domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the S_TK_X domain.

ProteinDescriptionDisease / phenotype
KPCG_HUMANOMIM:176980 : PROTEIN KINASE C, GAMMA; PRKCG
RK_HUMANOMIM:180381 : Oguchi disease-2
OMIM:258100 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a S_TK_X domain which could be assigned to a KEGG orthologous group, and not all proteins containing S_TK_X domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000961