The TBC domain within your query sequence starts at position 218 and ends at position 471, and its E-value is 2.35e-43.

SWSGIPKPVRPMTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYSSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYTDREDVDKVDVSSVPAEVLRNIEADTYWCMSKLLDGIQDNYTFAQPGIQMKVKMLEELVSRIDERVHRHLDGHEVRYLQFAFRWMNNLLMRELPLRCTIRLWDTYQSEPEGFSHFHLYVCAAFLVRWRREILEER
TBC

TBC

Domain in Tre-2, BUB2p, and Cdc16p. Probable Rab-GAPs.
SMART ACC:SM000164
Description:Widespread domain present in Gyp6 and Gyp7, thereby giving rise to the notion that it performs a GTP-activator activity on Rab-like GTPases.
InterPro ACC:IPR000195
InterPro abstract:

The ~200 amino acid TBC/rab GTPase-activating protein (GAP) domain is well conserved across species and has been found in a wide range of different proteins from plant adhesion molecules to mammalian oncogenes. The name TBC derives from the name of the murine protein Tbc1 in which this domain was first identified based on its similarity to sequences in the tre-2 oncogene, and the yeast regulators … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 36 093 TBC domains in 36 071 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TBC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TBC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein-binding, Rab-binding, GTPase activating

Relevant references for this domain

Primary literature for the TBC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TBC domain which could be assigned to a KEGG orthologous group, and not all proteins containing TBC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000195
PfamTBC