The cNMP domain within your query sequence starts at position 236 and ends at position 358, and its E-value is 1.23e-33.

TFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKA
cNMP

cNMP

Cyclic nucleotide-monophosphate binding domain
SMART ACC:SM000100
Description:Catabolite gene activator protein (CAP) is a prokaryotic homologue of eukaryotic cNMP-binding domains, present in ion channels, and cNMP-dependent kinases.
InterPro ACC:IPR000595
InterPro abstract:

Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [ PUBMED:14638413 PUBMED:10550204 PUBMED:1710853 ]. The best studied … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 149 838 cNMP domains in 136 080 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing cNMP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing cNMP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:CAMP-binding, cGMP-binding

Relevant references for this domain

Primary literature for the cNMP domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the cNMP domain.

ProteinDescriptionDisease / phenotype
KCNH2_HUMANOMIM:152427 : Long QT syndrome-2
CNGA3_HUMANOMIM:216900 : Achromatopsia
OMIM:600053 : Achromatopsia-2
OMIM:216900 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a cNMP domain which could be assigned to a KEGG orthologous group, and not all proteins containing cNMP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000595
PfamcNMP_binding