The TIR domain within your query sequence starts at position 601 and ends at position 742, and its E-value is 6.73e-20.

TPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVIAARNFVLVLSAGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR
TIR

TIR

Toll - interleukin 1 - resistance
SMART ACC:SM000255
Description: -
InterPro ACC:IPR000157
InterPro abstract:

This entry represents the Toll/interleukin-1 receptor (TIR) domain, which is the conserved cytoplasmic domain of approximately 200 amino acids, found in Toll-like receptors (TLRs) and their adaptors. Proteins containing this domain can also be found in plants, where they mediate disease resistance [ PUBMED:31439793 ] … expand

GO process:signal transduction (GO:0007165)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 18 356 TIR domains in 17 788 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TIR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TIR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TIR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TIR domain which could be assigned to a KEGG orthologous group, and not all proteins containing TIR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000157