The FHA domain within your query sequence starts at position 524 and ends at position 581, and its E-value is 6.9e-11.

VTRVGREDAERRQDIVLSGHFIKEEHCIFRSDSRGGGEAVVTLEPCEGADTYVNGKKV
FHA

FHA

Forkhead associated domain
SMART ACC:SM000240
Description:Found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain.
InterPro ACC:IPR000253
InterPro abstract:

The forkhead-associated (FHA) domain [ PUBMED:7482699 ] is a phosphopeptide recognition domain found in many regulatory proteins. It displays specificity for phosphothreonine-containing epitopes but will also recognise phosphotyrosine with relatively high affinity. It spans approximately 80-100 amino acid residues folded … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 73 373 FHA domains in 68 942 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FHA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FHA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the FHA domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the FHA domain.

ProteinDescriptionDisease / phenotype
CHK2_HUMANOMIM:604373 : Li-Fraumeni syndrome
OMIM:151623 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FHA domain which could be assigned to a KEGG orthologous group, and not all proteins containing FHA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFHA
InterProIPR000253
PROSITEFHA_DOMAIN