The PINc domain within your query sequence starts at position 55 and ends at position 154, and its E-value is 5.75e-12.

YHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKFRVALRIAKDPRFDRLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKR
PINc

PINc

Large family of predicted nucleotide-binding domains
SMART ACC:SM000670
Description:From similarities to 5'-exonucleases, these domains are predicted to be RNases. PINc domains in nematode SMG-5 and yeast NMD4p are predicted to be involved in RNAi.
InterPro ACC:IPR002716
InterPro abstract:

PIN domains are small protein domains identified by the presence of three strictly conserved acidic residues. Apart from these three residues, there is poor sequence conservation [ PUBMED:21036780 ]. PIN domains are found in eukaryotes, eubacteria and archaea. In eukaryotes they are ribonucleases involved in nonsense … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 39 194 PINc domains in 39 191 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PINc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PINc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation
Binding / catalysis:Nucleotides

Relevant references for this domain

Primary literature for the PINc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PINc domain which could be assigned to a KEGG orthologous group, and not all proteins containing PINc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002716