The domain within your query sequence starts at position 456 and ends at position 604; the E-value for the A2M_N_2 domain shown below is 5.22e-38.
LHLSVSRMELKPGDNLNVNFHLRTDPGHEAKIRYYTYLVMNKGKLLKAGRQVREPGQDLV VLSLPITPEFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCIGTLVVKGDPRDNHLA PGQQTTLRIEGNQGARVGLVAVDKGVFVL
A2M_N_2Alpha-2-Macroglobulin |
---|
SMART accession number: | SM01359 |
---|---|
Description: | This family includes a region of the alpha-2-macroglobulin family. |
Interpro abstract (IPR011625): | Alpha-2-macroglobulins (A2Ms) are plasma proteins that trap and inhibit a broad range of proteases and are major components of the eukaryotic innate immune system. However, A2M-like proteins were identified in pathogenically invasive bacteria and species that colonize higher eukaryotes. In human A2Ms, this domain encompasses macroglobulin-like domain MG5 and 6 including bait region. In Salmonella enterica ser A2Ms, this domain encompasses MG7 and MG8 including the bait region [ (PUBMED:25221932) (PUBMED:22290936) ]. The Bait region is cleaved by proteases, followed by a large conformational change that blocks the target protease within a cage-like complex. This model of protease entrapment is recognised as the Venus flytrap mechanism [ (PUBMED:25221932) ]. |
Family alignment: |
There are 13783 A2M_N_2 domains in 13732 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)