The domain within your query sequence starts at position 124 and ends at position 162; the E-value for the ACTH_domain domain shown below is 3.3e-17.

SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF

ACTH_domain

Corticotropin ACTH domain
ACTH_domain
SMART accession number:SM01363
Description: -
Interpro abstract (IPR013531):

Pro-opiomelanocortin is present in high levels in the pituitary and is processed into 3 major peptide families: adrenocorticotrophin (ACTH); alpha-, beta- and gamma-melanocyte- stimulating hormones (MSH); and beta-endorphin [ (PUBMED:2266117) ]. ACTH regulates the synthesis and release of glucocorticoids and, to some extent, aldosterone in the adrenal cortex. It is synthesised and released in response to corticotrophin-releasing factor at times of stress (i.e. heat, cold, infection, etc.), its release leading to increased metabolism. The action of MSH in man is poorly understood, but it may be involved in temperature regulation [ (PUBMED:2266117) ]. Full activity of ACTH resides in the first 20 N-terminal amino acids, the first 13 of which are identical to alpha-MSH [ (PUBMED:2266117) (PUBMED:2839146) ].

The function of this region is not known, though it is found near the centre of these proteins.

Family alignment:
View or

There are 3062 ACTH_domain domains in 1577 proteins in SMART's nrdb database.

Click on the following links for more information.