The domain within your query sequence starts at position 12 and ends at position 139; the E-value for the ADF domain shown below is 2.54e-35.
PELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQNISPEELKLELPERQPRFVVY SYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTE TWLKEKLA
ADFActin depolymerisation factor/cofilin -like domains |
---|
SMART accession number: | SM00102 |
---|---|
Description: | Severs actin filaments and binds to actin monomers. |
Interpro abstract (IPR002108): | The actin-depolymerising factor homology (ADF-H) domain is an ~150-amino acid motif that is present in three phylogenetically distinct classes of eukaryotic actin-binding proteins [ (PUBMED:9693358) (PUBMED:12207032) (PUBMED:9047337) ]:
Although these proteins are biochemically distinct and play different roles in actin dynamics, they all appear to use the ADF-H domain for their interactions with actin. The ADF-H domain consists of a six-stranded mixed beta-sheet in which the four central strands (beta2-beta5) are anti-parallel and the two edge strands (beta1 and beta6) run parallel with the neighbouring strands. The sheet is surrounded by two alpha-helices on each side [ (PUBMED:9693358) (PUBMED:12207032) (PUBMED:15522287) ]. |
GO function: | actin binding (GO:0003779) |
Family alignment: |
There are 9609 ADF domains in 8060 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)