The domain within your query sequence starts at position 2 and ends at position 98; the E-value for the ADF domain shown below is 1.56e-12.

VVLEDELQNISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQM
MYAGSKNRLVQTAELTKVFEIRTTDDLTETWLKEKLA

ADF

Actin depolymerisation factor/cofilin -like domains
ADF
SMART accession number:SM00102
Description: Severs actin filaments and binds to actin monomers.
Interpro abstract (IPR002108):

The actin-depolymerising factor homology (ADF-H) domain is an ~150-amino acid motif that is present in three phylogenetically distinct classes of eukaryotic actin-binding proteins [ (PUBMED:9693358) (PUBMED:12207032) (PUBMED:9047337) ]:

  • ADF/cofilins, which include ADF, cofilin, destrin, actophorin, coactosin, depactin and glia maturation factors (GMFs) beta and gamma. ADF/cofilins are small actin-binding proteins composed of a single ADF-H domain. They bind both actin-monomers and filaments and promote rapid filament turnover in cells by depolymerising/fragmenting actin filaments. ADF/cofilins bind ADP-actin with higher affinity than ATP-actin and inhibit the spontaneous nucleotide exchange on actin monomers
  • Twinfilins, which are actin monomer-binding proteins that are composed of two ADF-H domains
  • Abp1/Drebrins, which are relatively large proteins composed of an N-terminal ADF-H domain followed by a variable region and a C-terminal SH3 domain. Abp1/Drebrins interact only with actin filaments and do not promote filament depolymerisation or fragmentation

Although these proteins are biochemically distinct and play different roles in actin dynamics, they all appear to use the ADF-H domain for their interactions with actin.

The ADF-H domain consists of a six-stranded mixed beta-sheet in which the four central strands (beta2-beta5) are anti-parallel and the two edge strands (beta1 and beta6) run parallel with the neighbouring strands. The sheet is surrounded by two alpha-helices on each side [ (PUBMED:9693358) (PUBMED:12207032) (PUBMED:15522287) ].

GO function:actin binding (GO:0003779)
Family alignment:
View or

There are 9609 ADF domains in 8060 proteins in SMART's nrdb database.

Click on the following links for more information.