The domain within your query sequence starts at position 464 and ends at position 594; the E-value for the AIF_C domain shown below is 1.81e-87.

AGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQS
GTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNR
MPIARKIIKDG

AIF_C

Apoptosis-inducing factor, mitochondrion-associated, C-term
AIF_C
SMART accession number:SM01353
Description: This C-terminal domain appears to be a dimerization domain of the mitochondrial apoptosis-inducing factor 1. protein. The domain also appears at the C-terminus of FAD-dependent pyridine nucleotide-disulfide oxidoreductases. Apoptosis inducing factor (AIF) is a bifunctional mitochondrial flavoprotein critical for energy metabolism and induction of caspase-independent apoptosis. On reduction with NADH, AIF undergoes dimerization and forms tight, long-lived FADH2-NAD charge-transfer complexes proposed to be functionally important.
Family alignment:
View or

There are 1222 AIF_C domains in 1220 proteins in SMART's nrdb database.

Click on the following links for more information.