The domain within your query sequence starts at position 85 and ends at position 141; the E-value for the Agenet domain shown below is 4.54e-1.
FDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAK
AgenetTudor-like domain present in plant sequences. |
---|
SMART accession number: | SM00743 |
---|---|
Description: | Domain in plant sequences with possible chromatin-associated functions. |
Interpro abstract (IPR014002): | This entry represents an agenet domain found in EMSY-like (AtEML) proteins, which have possible roles in chromatin regulation and are related to the BRCA2-interacting human oncoprotein EMSY [ (PUBMED:21830950) ]. Proteins containing this domain also include MRG2 (AT1G02740) from Arabidopsis and PHD finger protein 20-like protein 1 (PHF20L1) from animals. MRG2 binds to the FLOWERING LOCUS T locus and elevates the expression in an H3K36me3-dependent manner [ (PUBMED:25183522) ]. The function of PHF20L1 is not clear. |
Family alignment: |
There are 8129 Agenet domains in 3554 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)