The domain within your query sequence starts at position 11 and ends at position 407; the E-value for the Amelin domain shown below is 7.19e-250.

MKGLILFLSLVKMSLAVPAFPQQPGAQGMAPPGMASLSLETMRQLGSLQGLNALSQYSRL
GFGKALNSLWLHGLLPPHNSFPWIGPREHETQQPSLQPHQPGLKPFLQPTAATGVQVTPQ
KPGPQPPMHPGQLPLQEGELIAPDEPQVAPSENPPTPEVPIMDFADPQFPTVFQIARSIS
RGPMAHNKASAFYPGMFYMSYGANQLNAPARIGFMSSEEMPGERGSPMAYGTLFPRFGGF
RQTLRRLNQNSPKGGDFTVEVDSPVSVTKGPEKGEGPEGSPLQEANPGKRENPALLSQMA
PGAHAGLLAFPNDHIPSMARGPAGQRLLGVTPAAADPLITPELAEVYETYGADVTTPLGD
GEATMDITMSPDTQQPLLPGNKVHQPQVHNAWRFQEP

Amelin

Ameloblastin precursor (Amelin)
Amelin
SMART accession number:SM00817
Description: This family consists of several mammalian Ameloblastin precursor (Amelin) proteins. Matrix proteins of tooth enamel consist mainly of amelogenin but also of non-amelogenin proteins, which, although their volumetric percentage is low, have an important role in enamel mineralisation. One of the non-amelogenin proteins is ameloblastin, also known as amelin and sheathlin. Ameloblastin (AMBN) is one of the enamel sheath proteins which is though to have a role in determining the prismatic structure of growing enamel crystals.
Interpro abstract (IPR007798):

This family consists of mammalian Ameloblastin precursor (Amelin) proteins. Matrix proteins of tooth enamel consist mainly of amelogenin but also of non-amelogenin proteins, which, although their volumetric percentage is low, have an important role in enamel mineralization. One of the non-amelogenin proteins is ameloblastin, also known as amelin and sheathlin. Ameloblastin (AMBN) is one of the enamel sheath proteins which is thought to have a role in determining the prismatic structure of growing enamel crystals [ (PUBMED:11867231) ].

GO process:odontogenesis of dentin-containing tooth (GO:0042475)
GO function:structural constituent of tooth enamel (GO:0030345)
Family alignment:
View or

There are 130 Amelin domains in 130 proteins in SMART's nrdb database.

Click on the following links for more information.