The domain within your query sequence starts at position 21 and ends at position 248; the E-value for the Arfaptin domain shown below is 1.54e-125.

VVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQ
KRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEV
ETFRHRAISDTWLTVNRMEQYRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLA
KKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTM

Arfaptin

Arfaptin-like domain
Arfaptin
SMART accession number:SM01015
Description: Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules. The structure of arfaptin shows that upon binding to a small GTPase, arfaptin forms an elongated, crescent-shaped dimer of three-helix coiled-coils. The N-terminal region of ICA69 is similar to arfaptin.
Interpro abstract (IPR010504):

The arfaptin homology (AH) domain is a protein domain found in a range of proteins, including arfaptins, protein kinase C-binding protein PICK1 [ (PUBMED:10623590) ] and mammalian 69kDa islet cell autoantigen (ICA69) [ (PUBMED:12682071) ]. The AH domain of arfaptin has been shown to dimerise and to bind Arf and Rho family GTPases [ (PUBMED:11346801) (PUBMED:11696355) ], including ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules.

The AH domain consists of three alpha-helices arranged as an extended antiparallel alpha-helical bundle. Two arfaptin AH domains associate to form a highly elongated, crescent-shaped dimer [ (PUBMED:11346801) (PUBMED:11696355) ].

GO function:protein domain specific binding (GO:0019904)
Family alignment:
View or

There are 3577 Arfaptin domains in 3576 proteins in SMART's nrdb database.

Click on the following links for more information.