The domain within your query sequence starts at position 623 and ends at position 675; the E-value for the BHD_1 domain shown below is 4.09e-25.

LDQPLPTSISTYKNHPLYALKRHLLKFQAIYPETAAVLGYCRGEAVYSRDCVH

BHD_1

Rad4 beta-hairpin domain 1
BHD_1
SMART accession number:SM01030
Description: This short domain is found in the Rad4 protein. This domain binds to DNA.
Interpro abstract (IPR018326):

This short domain is found in the Rad4 protein. This domain binds to DNA [ (PUBMED:17882165) ].

GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 1657 BHD_1 domains in 1656 proteins in SMART's nrdb database.

Click on the following links for more information.