The domain within your query sequence starts at position 677 and ends at position 737; the E-value for the BHD_2 domain shown below is 4.96e-24.

LHSRDTWLKQARVVRLGEVPYKMVKGFSNRARKARLSEPQLHDHNDLGLYGHWQTEEYQP
P

BHD_2

Rad4 beta-hairpin domain 2
BHD_2
SMART accession number:SM01031
Description: This short domain is found in the Rad4 protein. This domain binds to DNA.
Interpro abstract (IPR018327):

This short domain is found in the Rad4 protein. This domain binds to DNA [ (PUBMED:17882165) ].

GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 2099 BHD_2 domains in 2095 proteins in SMART's nrdb database.

Click on the following links for more information.