The domain within your query sequence starts at position 457 and ends at position 536; the E-value for the BID_2 domain shown below is 6.9e-2.
IYFPIQLKPSFLAFPHHPLGISNRFTVQVEGGSGNFTWSSSNETVAMVTTKGVVTAGQVR GNSTILARDVQNPSRSGDIK
BID_2Bacterial Ig-like domain 2 |
---|
SMART accession number: | SM00635 |
---|---|
Description: | - |
Interpro abstract (IPR003343): | Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins as well as in some uncharacterised eukaryote proteins. Intimin is a bacterial cell-adhesion molecule that mediates the intimate bacterial host-cell interaction. It contains three domains; two immunoglobulin-like domains and a C-type lectin-like module implying that carbohydrate recognition may be important in intimin-mediated cell adhesion [ (PUBMED:10201396) ]. |
Family alignment: |
There are 37760 BID_2 domains in 15247 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)