The domain within your query sequence starts at position 133 and ends at position 227; the E-value for the BRICHOS domain shown below is 9.46e-30.

FSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMTPKNLVELFGKLASGKYLPHT
YVVREDLVAVEEIRDVSNLGIFIYQLCNNRKSFRL

BRICHOS

BRICHOS
SMART accession number:SM01039
Description: The BRICHOS domain is about 100 amino acids long. It is found in a variety of proteins implicated in dementia, respiratory distress and cancer. Its exact function is unknown; roles that have been proposed for it include (a) in targeting of the protein to the secretory pathway, (b) intramolecular chaperone-like function, and (c) assisting the specialised intracellular protease processing system (PUBMED:12114016). This C-terminal domain is embedded in the endoplasmic reticulum lumen, and binds to the N-terminal, transmembrane, SP_C, PF08999 provided that it is in non-helical conformation. Thus the Brichos domain of proSP-C is a chaperone that induces alpha-helix formation of an aggregation-prone TM region (PUBMED:19472327) .
Interpro abstract (IPR007084):

The BRICHOS domain is found in a variety of proteins implicated in dementia, respiratory distress and cancer, including BRI-2, chondromodulin-I (ChM-I), CA11, and surfactant protein C [ (PUBMED:12114016) ]. Its exact function is unknown; roles that have been proposed for it include (a) targeting the protein to the secretory pathway, (b) an intramolecular chaperone-like function, and (c) assisting the specialised intracellular protease processing system [ (PUBMED:12114016) ].

Family alignment:
View or

There are 3414 BRICHOS domains in 3356 proteins in SMART's nrdb database.

Click on the following links for more information.