The domain within your query sequence starts at position 643 and ends at position 707; the E-value for the BRLZ domain shown below is 2.3e-14.

LEFIHDIRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNHLKACMGELL
DNFSC

BRLZ

basic region leucin zipper
BRLZ
SMART accession number:SM00338
Description: -
Interpro abstract (IPR004827):

The basic-leucine zipper (bZIP) domain transcription factors [ (PUBMED:7780801) ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region required for dimerisation.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)
Family alignment:
View or

There are 52073 BRLZ domains in 51906 proteins in SMART's nrdb database.

Click on the following links for more information.