The domain within your query sequence starts at position 64 and ends at position 103; the E-value for the Beta-TrCP_D domain shown below is 5.48e-26.

IKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQ

Beta-TrCP_D

D domain of beta-TrCP
Beta-TrCP_D
SMART accession number:SM01028
Description: This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found associated with F-box domain, WD domain. The protein that contains this domain functions as a ubiquitin ligase. Ubiquitination is required to direct proteins towards the proteasome for degradation. This protein is part of the WD40 class of F box proteins. The D domain of these F box proteins is involved in mediating the dimerisation of the protein. Dimerisation is necessary to polyubiquitinate substrates so this D domain is vital in directing substrates towards the proteasome for degradation.
Interpro abstract (IPR021977):

This entry represents the D domain of beta-TrCP, which is a member of the WD40 class of F box proteins, and functions as a ubiquitin ligase. The D domain of these F box proteins is involved in mediating dimerisation of the protein [ (PUBMED:17574027) ]. Dimerisation is necessary to polyubiquitinate substrates, so this D domain is vital in directing substrates towards the proteasome for degradation.

GO function:protein dimerization activity (GO:0046983)
Family alignment:
View or

There are 941 Beta-TrCP_D domains in 938 proteins in SMART's nrdb database.

Click on the following links for more information.