The domain within your query sequence starts at position 1791 and ends at position 1884; the E-value for the AKAP_110 domain shown below is 2e-8.

KTLLIMNIDMEPGAVDPQLRIILQWLIASEAEVAELYFQDSAKKEFILLSKQLQEKGWKV
GDVLQAVLKYYEVVEKPSREERCKSLFDWLLENA

The domain was found using the schnipsel database

AKAP_110

A-kinase anchor protein 110 kDa
AKAP_110
SMART accession number:SM00807
Description: This family consists of several mammalian protein kinase A anchoring protein 3 (PRKA3) or A-kinase anchor protein 110 kDa (AKAP 110) sequences. Agents that increase intracellular cAMP are potent stimulators of sperm motility. Anchoring inhibitor peptides, designed to disrupt the interaction of the cAMP-dependent protein kinase A (PKA) with A kinase-anchoring proteins (AKAPs), are potent inhibitors of sperm motility. PKA anchoring is a key biochemical mechanism controlling motility. AKAP110 shares compartments with both RI and RII isoforms of PKA and may function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction (PUBMED:10319321).
Interpro abstract (IPR020799):

This family consists of several mammalian protein kinase A anchoring protein 3 (PRKA3) or A-kinase anchor protein 110kDa (AKAP 110) sequences. Agents that increase intracellular cAMP are potent stimulators of sperm motility. Anchoring inhibitor peptides, designed to disrupt the interaction of the cAMP-dependent protein kinase A (PKA) with A kinase-anchoring proteins (AKAPs), are potent inhibitors of sperm motility. PKA anchoring is a key biochemical mechanism controlling motility. AKAP110 shares compartments with both RI and RII isoforms of PKA and may function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction [ (PUBMED:10319321) ].

Family alignment:
View or

There are 302 AKAP_110 domains in 301 proteins in SMART's nrdb database.

Click on the following links for more information.