The domain within your query sequence starts at position 2 and ends at position 54; the E-value for the Elp3 domain shown below is 5e-18.
GKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTR
The domain was found using the schnipsel database
Elp3Elongator protein 3, MiaB family, Radical SAM |
---|
SMART accession number: | SM00729 |
---|---|
Description: | This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases. |
Interpro abstract (IPR006638): | This domain is found in MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases [ (PUBMED:11222759) ]. |
GO function: | catalytic activity (GO:0003824), iron-sulfur cluster binding (GO:0051536) |
Family alignment: |
There are 276946 Elp3 domains in 276201 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)