The domain within your query sequence starts at position 405 and ends at position 486; the E-value for the IG_like domain shown below is 3e-31.

DAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQ
CRADNCHSHPAVFSEILRVRVI

The domain was found using the schnipsel database

IG_like

Immunoglobulin like
IG_like
SMART accession number:SM00410
Description: IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Family alignment:
View or

There are 91644 IG_like domains in 55038 proteins in SMART's nrdb database.

Click on the following links for more information.