The domain within your query sequence starts at position 1344 and ends at position 1428; the E-value for the IPPc domain shown below is 1e-17.

VKINGISGVKQEPTLKSDPFEDLSLSVLAVSKAQPSVQISPVLTPDPKMLIQLPSASQSQ
VNPLSSVSCMPTRPPGPEESKSQES

The domain was found using the schnipsel database

IPPc

Inositol polyphosphate phosphatase, catalytic domain homologues
IPPc
SMART accession number:SM00128
Description: Mg(2+)-dependent/Li(+)-sensitive enzymes.
Interpro abstract (IPR000300):

This domain is found in diverse proteins homologous to inositol monophosphatase [ (PUBMED:1660408) ]. These proteins are Mg 2+ -dependent/Li + -sensitive phosphatases that catalyse a variety of reactions.

GO process:phosphatidylinositol dephosphorylation (GO:0046856)
Family alignment:
View or

There are 12295 IPPc domains in 12285 proteins in SMART's nrdb database.

Click on the following links for more information.