The domain within your query sequence starts at position 36 and ends at position 118; the E-value for the Int_alpha domain shown below is 5e-25.

APAVLSSLLHQDPSNNQTCLLVARRSSNRNTAALYRCAISISPDEIACQPVEHICMPKGR
YQGVTLVGNHNGVLVCIQVQARK

The domain was found using the schnipsel database

Int_alpha

Integrin alpha (beta-propellor repeats).
Int_alpha
SMART accession number:SM00191
Description: Integrins are cell adhesion molecules that mediate cell-extracellular matrix and cell-cell interactions. They contain both alpha and beta subunits. Alpha integrins are proposed to contain a domain containing a 7-fold repeat that adopts a beta-propellor fold. Some of these domains contain an inserted von Willebrand factor type-A domain. Some repeats contain putative calcium-binding sites. The 7-fold repeat domain is homologous to a similar domain in phosphatidylinositol-glycan-specific phospholipase D.
Interpro abstract (IPR013519):

Integrins are cell adhesion molecules that mediate cell-extracellular matrix and cell-cell interactions. They contain both alpha and beta subunits. Alpha integrins are proposed to contain a domain containing a 7-fold repeat that adopts a beta-propellor fold. Some of these domains contain an inserted von Willebrand factor type-A domain. Some repeats contain putative calcium-binding sites. The 7-fold repeat domain is homologous to a similar domain in phosphatidylinositol-glycan-specific phospholipase D.

Family alignment:
View or

There are 70993 Int_alpha domains in 14903 proteins in SMART's nrdb database.

Click on the following links for more information.