The domain within your query sequence starts at position 604 and ends at position 654; the E-value for the KIND domain shown below is 2e-27.
NARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACK
The domain was found using the schnipsel database
KINDkinase non-catalytic C-lobe domain |
---|
SMART accession number: | SM00750 |
---|---|
Description: | It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features |
Interpro abstract (IPR011019): | The KIND (kinase non-catalytic C-lobe domain) is a putative protein interaction domain, which has been identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). The presence of the KIND domain at the N terminus of signalling proteins and the absence of the active site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of the domain only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features [ (PUBMED:12877999) (PUBMED:16099729) ]. In SPIRE1 (protein spire homologue 1) this domain interacts with FMN2 (formin-2) [ (PUBMED:21730168) (PUBMED:21705804) ]. |
Family alignment: |
There are 2650 KIND domains in 2324 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)