The domain within your query sequence starts at position 1282 and ends at position 1344; the E-value for the LPD_N domain shown below is 1e-21.

DGRVKYTMNRNKINIDIPLPLGGKSSKDLKMPESVRTPALNFKSVGFHLPSREVQVPTFT
IPK

The domain was found using the schnipsel database

LPD_N

Lipoprotein N-terminal Domain
LPD_N
SMART accession number:SM00638
Description: -
Interpro abstract (IPR001747):

This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [ (PUBMED:9687371) ].

Vitellinogen precursors provide the major egg yolk proteins that are a source of nutrients during early development of oviparous vertebrates and invertebrates. Vitellinogen precursors are multi-domain apolipoproteins that are cleaved into distinct yolk proteins. Different vitellinogen precursors exist, which are composed of variable combinations of yolk protein components; however, the cleavage sites are conserved. In vertebrates, a complete vitellinogen is composed of an N-terminal signal peptide for export, followed by four regions that can be cleaved into yolk proteins: lipovitellin-1, phosvitin, lipovitellin-2, and a von Willebrand factor type D domain (YGP40) [ (PUBMED:17314313) (PUBMED:12135361) ].

Microsomal triglyceride transfer protein (MTTP) is an endoplasmic reticulum lipid transfer protein involved in the biosynthesis and lipid loading of apolipoprotein B. MTTP is also involved in the late stage of CD1d trafficking in the lysosomal compartment, CD1d being the MHC I-like lipid antigen presenting molecule [ (PUBMED:17403933) ].

Apolipoprotein B can exist in two forms: B-100 and B-48. Apoliporotein B-100 is present on several lipoproteins, including very low-density lipoproteins (VLDL), intermediate density lipoproteins (IDL) and low density lipoproteins (LDL), and can assemble VLDL particles in the liver [ (PUBMED:16238675) ]. Apolipoprotein B-100 has been linked to the development of atherosclerosis.

GO process:lipid transport (GO:0006869)
GO function:lipid transporter activity (GO:0005319)
Family alignment:
View or

There are 3234 LPD_N domains in 3215 proteins in SMART's nrdb database.

Click on the following links for more information.