The domain within your query sequence starts at position 2 and ends at position 152; the E-value for the PKS_ER domain shown below is 8e-13.
GRKVTFFQPDDEVVGILPLDSEDPGLCEVIRVHEHYLVHKPEKVSWTEAAGVIRDGVRAC TALYYLSQLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTAHSLEDKQHLERLRPSIA RVIDVSNGKVHVAESCLEETGGLGVDIVIDA
The domain was found using the schnipsel database
PKS_EREnoylreductase |
---|
SMART accession number: | SM00829 |
---|---|
Description: | Enoylreductase in Polyketide synthases. |
Interpro abstract (IPR020843): | Modular polyketide synthases are giant multifunctional enzymes that biosynthesise a variety of secondary metabolites using various combinations of dehydratase (DH), ketoreductase (KR) and enoyl-reductase (ER) domains [ (PUBMED:20666435) ]. This entry represents the enoylreductase domain from a number of polyketide sythases. |
GO function: | oxidoreductase activity (GO:0016491) |
Family alignment: |
There are 10815 PKS_ER domains in 10295 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)