The domain within your query sequence starts at position 1 and ends at position 95; the E-value for the Sec63 domain shown below is 1e-60.
MNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKHPALKITRRYAFAHILTVLQCATVI GFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYL
The domain was found using the schnipsel database
Sec63Sec63 Brl domain |
---|
SMART accession number: | SM00973 |
---|---|
Description: | This domain was named after the yeast Sec63 (or NPL1) (also known as the Brl domain) protein in which it was found. This protein is required for assembly of functional endoplasmic reticulum translocons (PUBMED:16368690), (PUBMED:11023840). Other yeast proteins containing this domain include pre-mRNA splicing helicase BRR2, HFM1 protein and putative helicases. |
Interpro abstract (IPR004179): | This domain was named after the yeast Sec63 (or NPL1) (also known as the Brl domain) protein in which it was found. This protein is required for assembly of functional endoplasmic reticulum translocons [ (PUBMED:16368690) (PUBMED:11023840) ]. Other yeast proteins containing this domain include pre-mRNA splicing helicase BRR2, HFM1 protein and putative helicases. |
Family alignment: |
There are 9838 Sec63 domains in 6927 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)