The domain within your query sequence starts at position 37 and ends at position 179; the E-value for the Sec63 domain shown below is 3e-98.

GALSITALCTALAEPAWLHIHGGTCSRQELGVSDVLGYVNPDLLKDFCMNPQTVLLLRVI
AAFCFLGILCSLSAFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILA
QQQQHKKYHGSQVYVTFAVSFYL

The domain was found using the schnipsel database

Sec63

Sec63 Brl domain
Sec63
SMART accession number:SM00973
Description: This domain was named after the yeast Sec63 (or NPL1) (also known as the Brl domain) protein in which it was found. This protein is required for assembly of functional endoplasmic reticulum translocons (PUBMED:16368690), (PUBMED:11023840). Other yeast proteins containing this domain include pre-mRNA splicing helicase BRR2, HFM1 protein and putative helicases.
Interpro abstract (IPR004179):

This domain was named after the yeast Sec63 (or NPL1) (also known as the Brl domain) protein in which it was found. This protein is required for assembly of functional endoplasmic reticulum translocons [ (PUBMED:16368690) (PUBMED:11023840) ]. Other yeast proteins containing this domain include pre-mRNA splicing helicase BRR2, HFM1 protein and putative helicases.

Family alignment:
View or

There are 9838 Sec63 domains in 6927 proteins in SMART's nrdb database.

Click on the following links for more information.