The domain within your query sequence starts at position 651 and ends at position 688; the E-value for the Telomerase_RBD domain shown below is 1e-5.

LFSMLNYERTKHPHLMGSSVLGMNDIYRTWRAFVLRVR

The domain was found using the schnipsel database

Telomerase_RBD

Telomerase ribonucleoprotein complex - RNA binding domain
Telomerase_RBD
SMART accession number:SM00975
Description: Telomeres in most organisms are comprised of tandem simple sequence repeats (PUBMED:9671704). The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition (PUBMED:9671704). One major influence on telomere length is the enzyme telomerase (PUBMED:9671704). It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme (PUBMED:9671704). The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets (PUBMED:17997966). How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA (PUBMED:17997966).
Interpro abstract (IPR021891):

Telomeres in most organisms are comprised of tandem simple sequence repeats [ (PUBMED:9671704) ]. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition [ (PUBMED:9671704) ]. One major influence on telomere length is the enzyme telomerase [ (PUBMED:9671704) ]. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme [ (PUBMED:9671704) ]. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets [ (PUBMED:17997966) ]. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA [ (PUBMED:17997966) ].

GO function:RNA-directed DNA polymerase activity (GO:0003964)
Family alignment:
View or

There are 1299 Telomerase_RBD domains in 1298 proteins in SMART's nrdb database.

Click on the following links for more information.