The domain within your query sequence starts at position 38 and ends at position 73; the E-value for the Tubulin domain shown below is 2e-13.

GDLMEHLVPHPEFKMLGVRNIPQMSAASLAYSAFTW

The domain was found using the schnipsel database

Tubulin

Tubulin/FtsZ family, GTPase domain
Tubulin
SMART accession number:SM00864
Description: This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins. These proteins are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ and tubulin are GTPases, this entry is the GTPase domain. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in bacteria and archaea.
Interpro abstract (IPR003008):

This entry represents a GTPase domain found in all tubulin chains, such as tubulin alpha, beta and gamma chains, and some bacterial FtsZ proteins [ (PUBMED:9628483) ]. These proteins are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells [ (PUBMED:9144213) (PUBMED:9428770) ]. FtsZ and tubulin are GTPases, this entry is the GTPase domain. FtsZ can polymerise into tubes, sheets, and rings invitro and isubiquitous in bacteria and archaea.

GO function:GTPase activity (GO:0003924)
Family alignment:
View or

There are 39333 Tubulin domains in 39264 proteins in SMART's nrdb database.

Click on the following links for more information.