The domain within your query sequence starts at position 6 and ends at position 54; the E-value for the Tubulin_C domain shown below is 3e-20.

TCEETKTGVCLLQDGNQEPFKVRLHLARDLLMLQEQDVLCVSGEPFYSG

The domain was found using the schnipsel database

Tubulin_C

Tubulin/FtsZ family, C-terminal domain
Tubulin_C
SMART accession number:SM00865
Description: This domain is found in the tubulin alpha, beta and gamma chains, as well as the bacterial FtsZ family of proteins. These proteins are GTPases and are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in bacteria and archaea. This is the C-terminal domain.
Interpro abstract (IPR018316):

This domain is found in the tubulin alpha, beta and gamma chains, as well as the bacterial FtsZ family of proteins. These proteins are GTPases and are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in bacteria and archaea. This is the C-terminal domain.

Family alignment:
View or

There are 36892 Tubulin_C domains in 36813 proteins in SMART's nrdb database.

Click on the following links for more information.