The domain within your query sequence starts at position 135 and ends at position 174; the E-value for the UBX domain shown below is 1e-20.

PDMPMPLLSMLRIKSENGEQAFLLMMWPEDTIGDVRKLLA

The domain was found using the schnipsel database

UBX

Domain present in ubiquitin-regulatory proteins
UBX
SMART accession number:SM00166
Description: Present in FAF1 and Shp1p.
Interpro abstract (IPR001012):

The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast. The function of the UBX domain is not known although the fragment of avian FAF-1 containing the UBX domain causes apoptosis of transfected cells.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 11210 UBX domains in 11196 proteins in SMART's nrdb database.

Click on the following links for more information.